Recombinant Mouse Muellerian-inhibiting factor (Amh), partial (450-552aa), N-terminal 6xHis-tag, E. coli expression - 100 ug

https://www.gentaur.be/web/image/product.template/11752/image_1920?unique=3b5779a
(0 review)

460.00 € 460.0 EUR 460.00 € VAT Excluded

460.00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Purity: Greater than 90% as determined by SDS-PAGE.


    Target Name: Amh


    Uniprot No.: P27106


    Species: Mus musculus (Mouse)


    Source: E.coli


    Expression Region: 450-552aa


    Target Protein Sequence:

    DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

    Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


    Mol. Weight: 15.4 kDa


    Protein Length: Partial


    Tag Info: N-terminal 6xHis-tagged


    Form: Liquid or Lyophilized powder

    Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


    Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


    Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.


    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.