Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression, tag-free - 1 mg

https://www.gen.bg/web/image/product.template/8181/image_1920?unique=355a290
(0 review)

1,846.00 € 1846.0 EUR 1,846.00 € VAT Excluded

1,846.00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Type: Recombinant protein

    Expression system: E. coli

    Species: SARS-CoV-2, Pirola variant

    Tag: None

    Expression Region: 315-535 aa

    Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK