PBBR1MCS2- TAC- MCHERRY plasmid - 2ug

https://www.gentaur.be/web/image/product.template/2033/image_1920?unique=cc4050a
(0 review)

402.00 € 402.0 EUR 402.00 € VAT Excluded

402.00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pBBR1MCS2-Tac-mCherry

    Catalog No. PVT11376
    Packing 2ug

     

    pBBR1MCS2-Tac-mCherry Information

    Promoter: Tac

    Replicator: pBBR1 Rep, pBBR1 oriV

    Terminator: T7 Terminator

    Plasmid classification: red fluorescent protein expression plasmid; wide host plasmid.

    Plasmid size: 6195bp

    Plasmid label: mCherry

    Prokaryotic resistance: kanamycin Kanamycin

    Screening markers: DH5 alpha

    Cloned strain: DH5 alpha

    Culture conditions: 37 centigrade, aerobic, LB

    Expression host: Gram-negative bacteria

    5'sequencing primers: M13R:CAGGAAACAGCTATGACC

    3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

     

    pBBR1MCS2-Tac-mCherry Description
    Tac strong promoter activated the expression of mCherry red fluorescent protein.

     

    pBBR1MCS2-Tac-mCherry Sequence

    LOCUS       Exported                6195 bp ds-DNA     circular SYN 11-SEP-2016

    DEFINITION  synthetic circular DNA

    ACCESSION   .

    VERSION     .

    KEYWORDS    pBBR1MCS2-Tac-mCherry

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 6195)

      AUTHORS   .

      TITLE     Direct Submission

      JOURNAL   Exported Sunday, September 11, 2016 from SnapGene Viewer 3.1.4

    FEATURES             Location/Qualifiers

         source          1..6195

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         CDS             458..1252

                         /codon_start=1

                         /gene="aph(3')-II (or nptII)"

                         /product="aminoglycoside phosphotransferase from Tn5"

                         /note="NeoR/KanR"

                         /note="confers resistance to neomycin, kanamycin, and G418 

                         (Geneticin(R))"

                         /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                         VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                         SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                         GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                         LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

         protein_bind    1657..1678

                         /bound_moiety="E. coli catabolite activator protein"

                         /note="CAP binding site"

                         /note="CAP binding activates transcription in the presence 

                         of cAMP."

         promoter        1693..1723

                         /note="lac promoter"

                         /note="promoter for the E. coli lac operon"

         protein_bind    1731..1747

                         /bound_moiety="lac repressor encoded by lacI"

                         /note="lac operator"

                         /note="The lac repressor binds to the lac operator to 

                         inhibit transcription in E. coli. This inhibition can be 

                         relieved by adding lactose or 

                         isopropyl-beta-D-thiogalactopyranoside (IPTG)."

         primer_bind     1755..1771

                         /note="M13 rev"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         promoter        1792..1810

                         /note="T3 promoter"

                         /note="promoter for bacteriophage T3 RNA polymerase"

         primer_bind     1840..1856

                         /note="KS primer"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         promoter        complement(1910..1987)

                         /gene="lacI"

                         /note="lacI promoter"

         misc_feature    2033..2061

                         /note="tac promoter"

                         /note="strong E. coli promoter; hybrid between the trp and 

                         lac UV5 promoters"

         CDS             2108..2818

                         /codon_start=1

                         /product="monomeric derivative of DsRed fluorescent protein

                         (Shaner et al., 2004)"

                         /note="mCherry"

                         /note="mammalian codon-optimized"

                         /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG

                         TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF

                         EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                         GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA

                         EGRHSTGGMDELYK"

         terminator      2852..2899

                         /note="T7 terminator"

                         /note="transcription terminator for bacteriophage T7 RNA 

                         polymerase"

         primer_bind     complement(2941..2957)

                         /note="SK primer"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         promoter        complement(2990..3008)

                         /note="T7 promoter"

                         /note="promoter for bacteriophage T7 RNA polymerase"

         primer_bind     complement(3018..3034)

                         /note="M13 fwd"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         CDS             complement(3741..4403)

                         /codon_start=1

                         /product="replication protein for the broad-host-range 

                         plasmid pBBR1 from Bordetella bronchiseptica"

                         /note="pBBR1 Rep"

                         /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH

                         HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV

                         NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE

                         PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"

         rep_origin      4404..5173

                         /note="pBBR1 oriV"

                         /note="replication origin of the broad-host-range plasmid 

                         pBBR1 from Bordetella bronchiseptica; requires the pBBR1 

                         Rep protein for replication"

    ORIGIN

            1 accttcggga gcgcctgaag cccgttctgg acgccctggg gccgttgaat cgggatatgc

           61 aggccaaggc cgccgcgatc atcaaggccg tgggcgaaaa gctgctgacg gaacagcggg

          121 aagtccagcg ccagaaacag gcccagcgcc agcaggaacg cgggcgcgca catttccccg

          181 aaaagtgcca cctgggatga atgtcagcta ctgggctatc tggacaaggg aaaacgcaag

          241 cgcaaagaga aagcaggtag cttgcagtgg gcttacatgg cgatagctag actgggcggt

          301 tttatggaca gcaagcgaac cggaattgcc agctggggcg ccctctggta aggttgggaa

          361 gccctgcaaa gtaaactgga tggctttctt gccgccaagg atctgatggc gcaggggatc

          421 aagatctgat caagagacag gatgaggatc gtttcgcatg attgaacaag atggattgca

          481 cgcaggttct ccggccgctt gggtggagag gctattcggc tatgactggg cacaacagac

          541 aatcggctgc tctgatgccg ccgtgttccg gctgtcagcg caggggcgcc cggttctttt

          601 tgtcaagacc gacctgtccg gtgccctgaa tgaactgcag gacgaggcag cgcggctatc

          661 gtggctggcc acgacgggcg ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg

          721 aagggactgg ctgctattgg gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc

          781 tcctgccgag aaagtatcca tcatggctga tgcaatgcgg cggctgcata cgcttgatcc

          841 ggctacctgc ccattcgacc accaagcgaa acatcgcatc gagcgagcac gtactcggat

          901 ggaagccggt cttgtcgatc aggatgatct ggacgaagag catcaggggc tcgcgccagc

          961 cgaactgttc gccaggctca aggcgcgcat gcccgacggc gaggatctcg tcgtgaccca

         1021 tggcgatgcc tgcttgccga atatcatggt ggaaaatggc cgcttttctg gattcatcga

         1081 ctgtggccgg ctgggtgtgg cggaccgcta tcaggacata gcgttggcta cccgtgatat

         1141 tgctgaagag cttggcggcg aatgggctga ccgcttcctc gtgctttacg gtatcgccgc

         1201 tcccgattcg cagcgcatcg ccttctatcg ccttcttgac gagttcttct gagcgggact

         1261 ctggggttcg aaatgaccga ccaagcgacg cccaacctgc catcacgaga tttcgattcc

         1321 accgccgcct tctatgaaag gttgggcttc ggaatcgttt tccgggacgc cggctggatg

         1381 atcctccagc gcggggatct catgctggag ttcttcgccc acccccatgg gcaaatatta

         1441 tacgcaaggc gacaaggtgc tgatgccgct ggcgattcag gttcatcatg ccgtttgtga

         1501 tggcttccat gtcggcagaa tgcttaatga attacaacag tttttatgca tgcgcccaat

         1561 acgcaaaccg cctctccccg cgcgttggcc gattcattaa tgcagctggc acgacaggtt

         1621 tcccgactgg aaagcgggca gtgagcgcaa cgcaattaat gtgagttagc tcactcatta

         1681 ggcaccccag gctttacact ttatgcttcc ggctcgtatg ttgtgtggaa ttgtgagcgg

         1741 ataacaattt cacacaggaa acagctatga ccatgattac gccaagcgcg caattaaccc

         1801 tcactaaagg gaacaaaagc tgggtaccgg gccccccctc gaggtcgacg gtatcgataa

         1861 gcttgatatc gaattcgagc tcggtacctc gcgaatgcat ctagatcaca ttcaccaccc

         1921 tgaattgact ctcttccggg cgctatcatg ccataccgcg aaaggttttg cgccattcga

         1981 tggtgtccgg gatctcgacg ctctccctta tgcgactcct gcattaggaa atttgacaat

         2041 taatcatcgg ctcgtataat gtgtggaatg tctcatgagc ggatatttca cacaggaaac

         2101 agtattcatg gtgagcaagg gcgaggagga taacatggcc atcatcaagg agttcatgcg

         2161 cttcaaggtg cacatggagg gctccgtgaa cggccacgag ttcgagatcg agggcgaggg

         2221 cgagggccgc ccctacgagg gcacccagac cgccaagctg aaggtgacca agggtggccc

         2281 cctgcccttc gcctgggaca tcctgtcccc tcagttcatg tacggctcca aggcctacgt

         2341 gaagcacccc gccgacatcc ccgactactt gaagctgtcc ttccccgagg gcttcaagtg

         2401 ggagcgcgtg atgaacttcg aggacggcgg cgtggtgacc gtgacccagg actcctccct

         2461 gcaggacggc gagttcatct acaaggtgaa gctgcgcggc accaacttcc cctccgacgg

         2521 ccccgtaatg cagaagaaga ccatgggctg ggaggcctcc tccgagcgga tgtaccccga

         2581 ggacggcgcc ctgaagggcg agatcaagca gaggctgaag ctgaaggacg gcggccacta

         2641 cgacgctgag gtcaagacca cctacaaggc caagaagccc gtgcagctgc ccggcgccta

         2701 caacgtcaac atcaagttgg acatcacctc ccacaacgag gactacacca tcgtggaaca

         2761 gtacgaacgc gccgagggcc gccactccac cggcggcatg gacgagctgt acaagtaatt

         2821 aacctaggct gctgccaccg ctgagcaata actagcataa ccccttgggg cctctaaacg

         2881 ggtcttgagg ggttttttgc tgaaacctca ggcatttgag aagcacacgg tcacacatcg

         2941 gatccactag ttctagagcg gccgccaccg cggtggagct ccaattcgcc ctatagtgag

         3001 tcgtattacg cgcgctcact ggccgtcgtt ttacaacgtc gtgactggga aaaccctggc

         3061 gttacccaac ttaatcgcct tgcagcacat ccccctttcg ccagctggcg taatagcgaa

         3121 gaggcccgca ccgatcgccc ttcccaacag ttgcgcagcc tgaatggcga atggaaattg

         3181 taagcgttaa tattttgtta aaattcgcgt taaatttttg ttaaatcagc tcatttttta

         3241 accaataggc cgactgcgat gagtggcagg gcggggcgta atttttttaa ggcagttatt

         3301 ggtgccctta aacgcctggt gctacgcctg aataagtgat aataagcgga tgaatggcag

         3361 aaattcgaaa gcaaattcga cccggtcgtc ggttcagggc agggtcgtta aatagccgct

         3421 tatgtctatt gctggtttac cggtttattg actaccggaa gcagtgtgac cgtgtgcttc

         3481 tcaaatgcct gaggccagtt tgctcaggct ctccccgtgg aggtaataat tgacgatatg

         3541 atcatttatt ctgcctccca gagcctgata aaaacggtga atccgttagc gaggtgccgc

         3601 cggcttccat tcaggtcgag gtggcccggc tccatgcacc gcgacgcaac gcggggaggc

         3661 agacaaggta tagggcggcg aggcggctac agccgatagt ctggaacagc gcacttacgg

         3721 gttgctgcgc aacccaagtg ctaccggcgc ggcagcgtga cccgtgtcgg cggctccaac

         3781 ggctcgccat cgtccagaaa acacggctca tcgggcatcg gcaggcgctg ctgcccgcgc

         3841 cgttcccatt cctccgtttc ggtcaaggct ggcaggtctg gttccatgcc cggaatgccg

         3901 ggctggctgg gcggctcctc gccggggccg gtcggtagtt gctgctcgcc cggatacagg

         3961 gtcgggatgc ggcgcaggtc gccatgcccc aacagcgatt cgtcctggtc gtcgtgatca

         4021 accaccacgg cggcactgaa caccgacagg cgcaactggt cgcggggctg gccccacgcc

         4081 acgcggtcat tgaccacgta ggccgacacg gtgccggggc cgttgagctt cacgacggag

         4141 atccagcgct cggccaccaa gtccttgact gcgtattgga ccgtccgcaa agaacgtccg

         4201 atgagcttgg aaagtgtctt ctggctgacc accacggcgt tctggtggcc catctgcgcc

         4261 acgaggtgat gcagcagcat tgccgccgtg ggtttcctcg caataagccc ggcccacgcc

         4321 tcatgcgctt tgcgttccgt ttgcacccag tgaccgggct tgttcttggc ttgaatgccg

         4381 atttctctgg actgcgtggc catgcttatc tccatgcggt agggtgccgc acggttgcgg

         4441 caccatgcgc aatcagctgc aacttttcgg cagcgcgaca acaattatgc gttgcgtaaa

         4501 agtggcagtc aattacagat tttctttaac ctacgcaatg agctattgcg gggggtgccg

         4561 caatgagctg ttgcgtaccc ccctttttta agttgttgat ttttaagtct ttcgcatttc

         4621 gccctatatc tagttctttg gtgcccaaag aagggcaccc ctgcggggtt cccccacgcc

         4681 ttcggcgcgg ctccccctcc ggcaaaaagt ggcccctccg gggcttgttg atcgactgcg

         4741 cggccttcgg ccttgcccaa ggtggcgctg cccccttgga acccccgcac tcgccgccgt

         4801 gaggctcggg gggcaggcgg gcgggcttcg ccttcgactg cccccactcg cataggcttg

         4861 ggtcgttcca ggcgcgtcaa ggccaagccg ctgcgcggtc gctgcgcgag ccttgacccg

         4921 ccttccactt ggtgtccaac cggcaagcga agcgcgcagg ccgcaggccg gaggcttttc

         4981 cccagagaaa attaaaaaaa ttgatggggc aaggccgcag gccgcgcagt tggagccggt

         5041 gggtatgtgg tcgaaggctg ggtagccggt gggcaatccc tgtggtcaag ctcgtgggca

         5101 ggcgcagcct gtccatcagc ttgtccagca gggttgtcca cgggccgagc gaagcgagcc

         5161 agccggtggc cgctcgcggc catcgtccac atatccacgg gctggcaagg gagcgcagcg

         5221 accgcgcagg gcgaagcccg gagagcaagc ccgtagggcg ccgcagccgc cgtaggcggt

         5281 cacgactttg cgaagcaaag tctagtgagt atactcaagc attgagtggc ccgccggagg

         5341 caccgccttg cgctgccccc gtcgagccgg ttggacacca aaagggaggg gcaggcatgg

         5401 cggcatacgc gatcatgcga tgcaagaagc tggcgaaaat gggcaacgtg gcggccagtc

         5461 tcaagcacgc ctaccgcgag cgcgagacgc ccaacgctga cgccagcagg acgccagaga

         5521 acgagcactg ggcggccagc agcaccgatg aagcgatggg ccgactgcgc gagttgctgc

         5581 cagagaagcg gcgcaaggac gctgtgttgg cggtcgagta cgtcatgacg gccagcccgg

         5641 aatggtggaa gtcggccagc caagaacagc aggcggcgtt cttcgagaag gcgcacaagt

         5701 ggctggcgga caagtacggg gcggatcgca tcgtgacggc cagcatccac cgtgacgaaa

         5761 ccagcccgca catgaccgcg ttcgtggtgc cgctgacgca ggacggcagg ctgtcggcca

         5821 aggagttcat cggcaacaaa gcgcagatga cccgcgacca gaccacgttt gcggccgctg

         5881 tggccgatct agggctgcaa cggggcatcg agggcagcaa ggcacgtcac acgcgcattc

         5941 aggcgttcta cgaggccctg gagcggccac cagtgggcca cgtcaccatc agcccgcaag

         6001 cggtcgagcc acgcgcctat gcaccgcagg gattggccga aaagctggga atctcaaagc

         6061 gcgttgagac gccggaagcc gtggccgacc ggctgacaaa agcggttcgg caggggtatg

         6121 agcctgccct acaggccgcc gcaggagcgc gtgagatgcg caagaaggcc gatcaagccc

         6181 aagagacggc ccgag

    //

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.